PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr010789.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Nin-like
Protein Properties Length: 204aa    MW: 23270.9 Da    PI: 6.7506
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr010789.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.91.5e-2689136552
       RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++l++++kyF+ pi++AAkeL+v+lTvLKr+CR+++I+RWPhRkiksl
  Pbr010789.1  89 LELDEIQKYFDVPITQAAKELKVGLTVLKRRCRELNIMRWPHRKIKSL 136
                  7899******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.88167157IPR003035RWP-RK domain
PfamPF020426.4E-2489136IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGSQDFEDSG IWDYILNDAA FPSPFGYEVV DEKPLTTMAE SVDCSNSVSG DSDDVLRTIE  60
LGMKIWGKDE DESRTKNESC CKKRCGTPLE LDEIQKYFDV PITQAAKELK VGLTVLKRRC  120
RELNIMRWPH RKIKSLNALI ENVKGMGLTN DVMMLEEHKR VLQQMPDMEL PERAKRLRQA  180
CFKTNYKKKR ALCLTALPVH DLV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368769.11e-151PREDICTED: protein RKD4-like
SwissprotQ9LVU82e-41RKD4_ARATH; Protein RKD4
TrEMBLA0A061G1541e-60A0A061G154_THECC; RWP-RK domain-containing protein, putative
STRINGSolyc03g083040.1.12e-49(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.19e-43RWP-RK domain-containing protein